DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab11

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster


Alignment Length:178 Identity:79/178 - (44%)
Similarity:126/178 - (70%) Gaps:4/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQ 66
            ::|.:|||:||:|::||||:.|:.|||:..|.....:||||:|..:::||:|:.||.||||||||
  Fly     6 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 70

  Fly    67 ERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTD-RDDREIP 130
            ||:|:||.:|||.|...:|||||:...|::.:..||||::::|:..::.:|||||:| |..|.:|
  Fly    71 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVP 135

  Fly   131 TQIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAE---LIGQARSKD 175
            |...:.||:::.:.|:||||.::.|||..|..|..|   ::.|.:.:|
  Fly   136 TDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRD 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 77/169 (46%)
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 76/163 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.