DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab26

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:200 Identity:83/200 - (41%)
Similarity:128/200 - (64%) Gaps:15/200 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQG-ATIGVDFMIKTVEVEGEKIKLQIWDTAG 65
            :::..:.|::::|::|||||.|:.||..|.:.|... :|:|:||..|.|.|:|.::|||||||||
  Fly   207 DEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAG 271

  Fly    66 QERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTD--RDDRE 128
            ||||||:|.:|||.||||:|:||::.:.|:|.:..||.||:|||...|:.:|:|||.|  ..:|:
  Fly   272 QERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQ 336

  Fly   129 IPTQIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAEL--IGQARSKDG----------SSSAA 181
            :..:.||...::|::.|:|||||...|||..|..:|.:|  .|.....||          ::.|.
  Fly   337 VKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFVRDNTKAR 401

  Fly   182 AAAAQ 186
            :..||
  Fly   402 SVCAQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 77/170 (45%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 82/192 (43%)
RAB 214..378 CDD:197555 77/163 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454471
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.