DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab8

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster


Alignment Length:204 Identity:83/204 - (40%)
Similarity:135/204 - (66%) Gaps:15/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQER 68
            |.:|||::|:|::||||||::.||::..|.....:|||:||.|:|:|::.:||||||||||||||
  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69

  Fly    69 FRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTD-RDDREIPTQ 132
            ||:||.:|||.|..::|||||:.:.:|:.:.:|:|.|:|.|::.|.|:|:|||.: .|.|::..:
  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKE 134

  Fly   133 IGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIGQARSKDGSSSAAAAAAQRQSEGSSIGLG 197
            .||:.|.::.:.|:|||||.:.|||..|..:|:::              .|..:::.|.::...|
  Fly   135 RGEQLAIEYGIKFMETSAKASINVEEAFLTLASDI--------------KAKTEKRMEANNPPKG 185

  Fly   198 SFSAKAAQS 206
            ....|...|
  Fly   186 GHQLKPMDS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 78/164 (48%)
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 77/179 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.