DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab2

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster


Alignment Length:226 Identity:93/226 - (41%)
Similarity:131/226 - (57%) Gaps:35/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQER 68
            |.:|||.:::|:.||||:||:.:||...|.|....||||:|..:.:.::|::||||||||||||.
  Fly     3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEA 67

  Fly    69 FRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDRDD-REIPTQ 132
            |||||:||||.|...:|||||:.:.||:.|..||.:.::::||.::.:|:|||:|.|. ||:..:
  Fly    68 FRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLDSRREVKKE 132

  Fly   133 IGEEFAKQHDMYFLETSAKEAENVERLFYEIAAEL-------------------IGQARSKDGSS 178
            .||.||::|.:.|:||||:.|.|||..|...|.|:                   |||..|....|
  Fly   133 EGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNPS 197

  Fly   179 SAAAAAAQRQSEGSSIGLGSFSAKAAQSNCC 209
            ...|..|               |.||.|.||
  Fly   198 LPGAGGA---------------AGAANSGCC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 80/183 (44%)
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 91/224 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.