DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab35

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster


Alignment Length:208 Identity:85/208 - (40%)
Similarity:124/208 - (59%) Gaps:14/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQER 68
            :..|||::::|::||||:.|:.||:...|......||||||.|:||::||.::||||||||||||
  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69

  Fly    69 FRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDRDDREIP-TQ 132
            ||:||.:|||..|.:|:|||::...:|..:..||.|||...: .|.|:|||||.|..||::. |:
  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCD-VVKKVLVGNKNDDPDRKVVITE 133

  Fly   133 IGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIG-QARSKDGSSSAAAAAAQRQSEGSSIGL 196
            ..:.||||.|:...|||||:..|||.:|..|..:::. :.|:............:...:||..| 
  Fly   134 DAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGSKGG- 197

  Fly   197 GSFSAKAAQSNCC 209
                      .||
  Fly   198 ----------KCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 79/164 (48%)
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 85/208 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.