DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab9Fa

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_727471.1 Gene:Rab9Fa / 326230 FlyBaseID:FBgn0052671 Length:197 Species:Drosophila melanogaster


Alignment Length:170 Identity:62/170 - (36%)
Similarity:100/170 - (58%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKI--KLQIWDT 63
            |..|...|||:::|::|||||||:.||:...|.....:|:|:|....:||....::  .||:|||
  Fly     1 MSQYDNPFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDT 65

  Fly    64 AGQERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKT-DRDDR 127
            :..|||:.:..:..||||.::|||||:...:|..:..|::||:.....||..:|||||: |.:.|
  Fly    66 SDDERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVTVLLVGNKSDDPNHR 130

  Fly   128 EIPTQIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAEL 167
            ::....|..:|.:..:.|.|.|||...||..:|..:|.::
  Fly   131 QVSMAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLAMDI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 62/170 (36%)
Rab9FaNP_727471.1 RAB 8..171 CDD:197555 60/163 (37%)
Rab 8..167 CDD:206640 59/158 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.