DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab9Fb

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_727472.1 Gene:Rab9Fb / 32029 FlyBaseID:FBgn0052670 Length:214 Species:Drosophila melanogaster


Alignment Length:214 Identity:78/214 - (36%)
Similarity:120/214 - (56%) Gaps:6/214 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAG 65
            |..|.:||||:::|:.||||:||:.||:...|......|:|:||.::.||:.|..:.||||||||
  Fly     1 MSQYDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAG 65

  Fly    66 QERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNK-TDRDDREI 129
            .|||:|:..||||.||.::|||||:...:|..:..||:||:..::..|..:||||| .|.|:|::
  Fly    66 DERFKSLLPSYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQV 130

  Fly   130 PTQIGEEFAKQHDMYFLETSAKEAENVERLFYEIAA----ELIGQARSKDGSSSAAAAAAQRQSE 190
            ..:.|..:|....:.|.|.|||...||..:|..::.    .|:....::..........|:...|
  Fly   131 RMEQGFNYANHRALGFYEVSAKSGANVNDVFNMLSVGIYNRLVIHTPNRLSGGQETEDTAEPPDE 195

  Fly   191 GSSIGLGSFSAKAAQSNCC 209
            ..::. |....:|..||.|
  Fly   196 PINLA-GKDRQRAKDSNTC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 70/171 (41%)
Rab9FbNP_727472.1 RAB 8..171 CDD:197555 67/162 (41%)
Rab 8..165 CDD:206640 67/156 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.