DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab27

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:220 Identity:69/220 - (31%)
Similarity:113/220 - (51%) Gaps:39/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEG----EKIKLQIWDTAGQERF 69
            :.:::|::|||||||:.::|.|.|.....:|:|:||..|.:....    .:|.||||||||||||
  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDTAGQERF 83

  Fly    70 RSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLK-ILVGNKTD--------RD 125
            ||:|.::||.|...:|::|::.:.:|....:||.:::.:|.|:... :|.|||.|        ||
  Fly    84 RSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRD 148

  Fly   126 DREIPTQIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIGQARSKDGSSSAAAAAAQRQSE 190
                  |:. ...:::.:.::||||....||:    |....|:|:...:     ...||..|:  
  Fly   149 ------QVA-ALCRRYRLPYIETSACTGANVK----EAVELLVGRVMER-----IENAACNRE-- 195

  Fly   191 GSSIGLGSFSAKAAQSNCCGGLASG 215
                    ||....||.|...:|.|
  Fly   196 --------FSLLLTQSRCLPNIAYG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 57/171 (33%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 59/183 (32%)
RAB 20..186 CDD:197555 59/176 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.