DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab30

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_006229754.1 Gene:Rab30 / 308821 RGDID:1309507 Length:203 Species:Rattus norvegicus


Alignment Length:210 Identity:134/210 - (63%)
Similarity:164/210 - (78%) Gaps:13/210 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAG 65
            ||||.|||||||:|||||||||||||||||||||||||||||||||||||:.|||:|||||||||
  Rat     3 MEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAG 67

  Fly    66 QERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTD-RDDREI 129
            |||||||||||||||:||||.|||:|:.:|.|||:|||||::||::||:.:|||||.| .:.||:
  Rat    68 QERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREV 132

  Fly   130 PTQIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIGQARSKDGSSSAAAAAAQRQSEGSSI 194
            ..|..|||::..|||:|||||||::|||:||.::|..||.:||.   ::.....::....||.||
  Rat   133 SQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQ---NTLVNNVSSPLPGEGKSI 194

  Fly   195 GLGSFSAKAAQSNCC 209
                     :...||
  Rat   195 ---------SYLTCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 124/167 (74%)
Rab30XP_006229754.1 Rab30 3..171 CDD:133314 125/168 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354341
Domainoid 1 1.000 247 1.000 Domainoid score I2097
eggNOG 1 0.900 - - E1_KOG0095
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22815
Inparanoid 1 1.050 269 1.000 Inparanoid score I2943
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0007336
OrthoInspector 1 1.000 - - oto97020
orthoMCL 1 0.900 - - OOG6_110019
Panther 1 1.100 - - LDO PTHR47977
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5453
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.