DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab35

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001013064.1 Gene:Rab35 / 288700 RGDID:1306362 Length:201 Species:Rattus norvegicus


Alignment Length:208 Identity:91/208 - (43%)
Similarity:128/208 - (61%) Gaps:11/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQE 67
            ||..|||::::|::||||:.|:.||....|......||||||.|:|||:.|||:|||||||||||
  Rat     4 DYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQE 68

  Fly    68 RFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDRDDRE-IPT 131
            |||:||.:|||..|.:|:|||::...:|..:..||.||.:..:. |.:||||||.|..:|: :.|
  Rat    69 RFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDD-VCRILVGNKNDDPERKVVET 132

  Fly   132 QIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIGQARSKDGSSSAAAAAAQRQSEGSSIGL 196
            :...:||.|..:...||||||..|||.:| ....||:.:|: ||.     .|..|:|.:...:.|
  Rat   133 EDAYKFAGQMGIQLFETSAKENVNVEEMF-NCITELVLRAK-KDN-----LAKQQQQQQNDVVKL 190

  Fly   197 GSFSAKAAQSNCC 209
            ...|.:  :..||
  Rat   191 TKNSKR--KKRCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 80/165 (48%)
Rab35NP_001013064.1 Rab35 3..201 CDD:133310 89/206 (43%)
Effector region. /evidence=ECO:0000250 37..45 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.