DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab12

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_037149.1 Gene:Rab12 / 25530 RGDID:3527 Length:243 Species:Rattus norvegicus


Alignment Length:165 Identity:85/165 - (51%)
Similarity:116/165 - (70%) Gaps:2/165 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQERFR 70
            |..:::::|:.|||||.|:.|||...|.....:|:||||.|||||:.|:||:||||||||||||.
  Rat    40 FKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFN 104

  Fly    71 SITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTD-RDDREIPTQIG 134
            |||.:|||||..:||||||:.:.|||.||.|::.|.:||:.....:|||||.| ..||||..|.|
  Rat   105 SITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREISRQQG 169

  Fly   135 EEFAKQ-HDMYFLETSAKEAENVERLFYEIAAELI 168
            |:||:| ..|.|.|.|||:..||:.:|.::..:::
  Rat   170 EKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDIL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 85/163 (52%)
Rab12NP_037149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Rab12 42..243 CDD:206699 84/163 (52%)
Effector region. /evidence=ECO:0000250 70..78 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.