DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and rab-30

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_499328.1 Gene:rab-30 / 176476 WormBaseID:WBGene00004282 Length:216 Species:Caenorhabditis elegans


Alignment Length:214 Identity:136/214 - (63%)
Similarity:164/214 - (76%) Gaps:7/214 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAG 65
            |||||:|||:|||||||||||||||:||||:|||||.||||||||||||:|..:|||||||||||
 Worm     1 MEDYKYLFKVVLVGNAGVGKTCLVRKFTQGIFPPGQSATIGVDFMIKTVKVGNDKIKLQIWDTAG 65

  Fly    66 QERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDR-DDREI 129
            |||||||||||||||||::||||:||||:|||||:||.||:.|||.:|||||||||.|: |:||:
 Worm    66 QERFRSITQSYYRSAHAIVLVYDVSCQPSFDCLPEWLGEIESYANRRVLKILVGNKVDKGDEREV 130

  Fly   130 PTQIGEEFA--KQHDMYFLETSAKEAENVERLFYEIAAELIGQARSKDG--SSSAAAAAAQRQSE 190
            |.:||.:|:  .|.| |||||||.:|.||::||.::|..|....:..|.  ....|.|.....|.
 Worm   131 PERIGRDFSDVNQFD-YFLETSALDATNVDQLFEQVATRLTNDMKLTDERVHQFRADATNSSSST 194

  Fly   191 GSSIGLGSFSAKAAQSNCC 209
            |..|.|.. .|:...::||
 Worm   195 GGPIKLID-RAQTQLNSCC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 125/169 (74%)
rab-30NP_499328.1 P-loop_NTPase 1..170 CDD:304359 125/169 (74%)
RAB 8..169 CDD:197555 119/161 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167740
Domainoid 1 1.000 245 1.000 Domainoid score I1215
eggNOG 1 0.900 - - E1_KOG0095
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22815
Inparanoid 1 1.050 264 1.000 Inparanoid score I1885
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 1 1.000 - - FOG0007336
OrthoInspector 1 1.000 - - oto19118
orthoMCL 1 0.900 - - OOG6_110019
Panther 1 1.100 - - LDO PTHR47977
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4448
SonicParanoid 1 1.000 - - X5453
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.830

Return to query results.
Submit another query.