DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab30 and Rab15

DIOPT Version :9

Sequence 1:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_598811.3 Gene:Rab15 / 104886 MGIID:1916865 Length:212 Species:Mus musculus


Alignment Length:215 Identity:90/215 - (41%)
Similarity:133/215 - (61%) Gaps:14/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDYKFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQ 66
            :.|..||:::|:|::|||||||:.|||...|.....:||||||.:||:||:|.|:::||||||||
Mouse     3 KQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQ 67

  Fly    67 ERFRSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSKVLKILVGNKTDRDD-REIP 130
            ||:::||:.|||.|..:.||||||.:.::..:..|:.::.|||...|.|||:|||.|.:. |::.
Mouse    68 ERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVG 132

  Fly   131 TQIGEEFAKQHDMYFLETSAKEAENVERLFYEIAAELIGQARSK--DG----SSSAAAAAAQRQS 189
            .:.|::.||::.|.|.||||....|::..|..: .||:.||..|  ||    :|:..|.|...:.
Mouse   133 REQGQQLAKEYGMDFYETSACTNLNIKESFTRL-TELVLQAHRKELDGLRTRASNELALAELEED 196

  Fly   190 EGSSIGLGSFSAKAAQSNCC 209
            ||...|      .|..|..|
Mouse   197 EGKPEG------PANSSKTC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 75/166 (45%)
Rab15NP_598811.3 Rab15 9..172 CDD:206698 74/163 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..212 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1149105at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.