DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and ORT1

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_014773.4 Gene:ORT1 / 854297 SGDID:S000005656 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:316 Identity:89/316 - (28%)
Similarity:145/316 - (45%) Gaps:44/316 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEVEISTEKK---SNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQT-----MPTPPPGQPPRYK 57
            ||:    ::||   ...:...|.|.:.|.|..::..|.||:||||||     .||          
Yeast     1 MED----SKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPT---------- 51

  Fly    58 GVIDCAARTFRYEGF-RGFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAG 121
             ...|...|::.||. |||::||::||||.....|..|..|....:..:...::. ...||..:|
Yeast    52 -TWSCIKFTYQNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVS-PLGQILISG 114

  Fly   122 ALAGVCSALVTVPTDRIKVLLQTQT--VSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRD 184
            .:||.|::||..|.:.:|..||...  |::....:...:.|...:..:.|:..|::|.....:|:
Yeast   115 GVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRE 179

  Fly   185 SPTGF-YFVTYEFLQE-------LARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQ 241
            |..|. :|.|||.:::       |...|....||  ...::|||:||:.|.....|.|.:||.:|
Yeast   180 SFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKI--WELLISGGSAGLAFNASIFPADTVKSVMQ 242

  Fly   242 SAPEGTYKH-GIRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDL 296
            :      :| .:.:..:.:....|.|..:||:...|.||.|:.||||:..|..:.|
Yeast   243 T------EHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETLSAL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 33/105 (31%)
Mito_carr 111..205 CDD:278578 25/103 (24%)
Mito_carr 208..297 CDD:278578 28/90 (31%)
ORT1NP_014773.4 Mito_carr 16..101 CDD:395101 31/95 (33%)
Mito_carr 103..200 CDD:395101 24/97 (25%)
Mito_carr 209..289 CDD:395101 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.