DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and BAC2

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_178108.1 Gene:BAC2 / 844329 AraportID:AT1G79900 Length:296 Species:Arabidopsis thaliana


Alignment Length:286 Identity:96/286 - (33%)
Similarity:145/286 - (50%) Gaps:30/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGIS 80
            :.|:|||.||:..::.|:||||:::|.|        |..:.........|....||....|||::
plant    14 REFVAGGFGGVAGIISGYPLDTLRIRQQ--------QSSKSGSAFSILRRMLAIEGPSSLYRGMA 70

  Fly    81 APLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCS----ALVTVPTDRIKVL 141
            |||..||...|:.|.:||...|.|  |..:.|..|..:...||.||.:    :|:..|.:.||:.
plant    71 APLASVTFQNAMVFQIYAIFSRSF--DSSVPLVEPPSYRGVALGGVATGAVQSLLLTPVELIKIR 133

  Fly   142 LQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPT-GFYFVTYEFLQEL----A 201
            ||.|...:||      |..|..:.|:.|::.|::|....:|||:|. |.||.|||:::|.    .
plant   134 LQLQQTKSGP------ITLAKSILRRQGLQGLYRGLTITVLRDAPAHGLYFWTYEYVRERLHPGC 192

  Fly   202 RKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVFRNLMATEGPK 266
            ||   .|:.:..:.:::||.||:..|....|.||:|:|||.. .|.|: ||...||..:..||..
plant   193 RK---TGQENLRTMLVAGGLAGVASWVACYPLDVVKTRLQQG-HGAYE-GIADCFRKSVKQEGYT 252

  Fly   267 ALFRGILPILLRAFPSTAAVFFGVEL 292
            .|:||:...:.|||....|:|...|:
plant   253 VLWRGLGTAVARAFVVNGAIFAAYEV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 31/90 (34%)
Mito_carr 111..205 CDD:278578 34/102 (33%)
Mito_carr 208..297 CDD:278578 30/85 (35%)
BAC2NP_178108.1 Mito_carr <30..94 CDD:365909 24/71 (34%)
Mito_carr 111..189 CDD:365909 29/83 (35%)
Mito_carr 204..285 CDD:365909 29/77 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101471
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.