DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and slc25a15a

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001074107.1 Gene:slc25a15a / 791156 ZFINID:ZDB-GENE-070112-1072 Length:303 Species:Danio rerio


Alignment Length:305 Identity:81/305 - (26%)
Similarity:130/305 - (42%) Gaps:31/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NPVKSFI----AGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFR 73
            :||...:    ||..||...|:.|.|.||.||::||.       |..|:|.:.|....::..|.|
Zfish     4 HPVTQAVIDLSAGACGGTACVISGQPFDTAKVKMQTF-------PGLYRGFVHCFVSVYKQVGLR 61

  Fly    74 GFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQ----TDDHIRLTYPQIFAAGALAGVCSALVTVP 134
            |.|:|.:..|:......||.|..|...:.:.:    .|.:..|:..|...:|::|.|.|:|...|
Zfish    62 GLYQGTTPALIANIAENAVLFMSYGFCQNVVRFLSGLDRNTELSDVQKACSGSVASVFSSLALCP 126

  Fly   135 TDRIKVLLQTQTVSNGPLLYNGTIDTAAK---------LYRQGGIRSLFKGTCACILRDSPTGF- 189
            |:.:|..||.......    :|.|.:..|         :.|..|....::|....|:|:.|..| 
Zfish   127 TELVKCRLQAMHEMEA----SGKIASGQKSTVWSVVRNVLRTNGPLGFYQGLTTTIVRELPGYFC 187

  Fly   190 YFVTYEFLQELARKKSANGK--ISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGI 252
            :|..||..:.:.....|..|  |.....:.|||..|...|.:..|.|.:|||:|.......:.|.
Zfish   188 FFGGYELSRSIFAHHMATDKEHIGVVPLMFSGGFGGACLWLVVYPIDCVKSRIQVLSLAGKQEGF 252

  Fly   253 RSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDLL 297
            ......::..||...|:.|:.|.::|.||:..|:|...|::...:
Zfish   253 IKTLMGILRNEGVAPLYSGLTPTMIRTFPANGALFLAYEVSRKFM 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 29/101 (29%)
Mito_carr 111..205 CDD:278578 25/103 (24%)
Mito_carr 208..297 CDD:278578 25/90 (28%)
slc25a15aNP_001074107.1 Mito_carr 9..93 CDD:278578 27/90 (30%)
Mito_carr 103..202 CDD:278578 25/102 (25%)
Mito_carr 208..299 CDD:278578 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.