DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and SLC25A20

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_000378.1 Gene:SLC25A20 / 788 HGNCID:1421 Length:301 Species:Homo sapiens


Alignment Length:290 Identity:137/290 - (47%)
Similarity:190/290 - (65%) Gaps:3/290 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKSNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRG 74
            |..:|:|:.:|||.||:|.|.|||||||:||||||.|...|||||.|.|..||..:|...||..|
Human     6 KPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITG 70

  Fly    75 FYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIK 139
            .|||::||::||||::||.|..:..||:|.|......|:|||:||||.|:||.:..:..|.:|||
Human    71 LYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIK 135

  Fly   140 VLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYEFLQELARK 203
            .|||.| .|:|...|.||:|.|.|||::.|||.::|||...::||.| :|.||:|||:|:.:...
Human   136 CLLQIQ-ASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTP 199

  Fly   204 KSAN-GKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVFRNLMATEGPKA 267
            :... .::|....:::||.|||..|.:|:|.||||||.|:||.|.|.:|.|.|.|.|:..||..:
Human   200 EGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTS 264

  Fly   268 LFRGILPILLRAFPSTAAVFFGVELTNDLL 297
            |::|...:::||||:.||.|.|.|:....|
Human   265 LYKGFNAVMIRAFPANAACFLGFEVAMKFL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 53/96 (55%)
Mito_carr 111..205 CDD:278578 45/94 (48%)
Mito_carr 208..297 CDD:278578 38/88 (43%)
SLC25A20NP_000378.1 Mito_carr 6..103 CDD:395101 53/96 (55%)
Solcar 1 8..99 50/90 (56%)
Mito_carr 106..198 CDD:395101 45/92 (49%)
Solcar 2 108..196 45/88 (51%)
Mito_carr 205..294 CDD:395101 38/88 (43%)
Solcar 3 207..293 38/85 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I5022
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 332 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 1 1.000 - - otm40359
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45624
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 1 1.000 - - X2353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.