DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and slc25a20l

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_031746643.1 Gene:slc25a20l / 779503 XenbaseID:XB-GENE-5944561 Length:303 Species:Xenopus tropicalis


Alignment Length:293 Identity:134/293 - (45%)
Similarity:185/293 - (63%) Gaps:4/293 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STEKKSNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEG 71
            |..:.:.|||:.||||:||||.:|.|.|||||||.|||.|:|..||.|.|...:.|.::....||
 Frog     5 SKTQTAPPVKNVIAGGIGGMCLILAGQPLDTIKVNLQTQPSPALGQQPLYNSTLHCFSKIIAREG 69

  Fly    72 FRGFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTD 136
            .||.|||:.|||..||||.::.|..:..||.|.||.....|...|:|.||.|||:.|.::..|.:
 Frog    70 IRGLYRGMGAPLAVVTPIMSITFVGFGLGKSLQQTSPDSILRSWQVFVAGMLAGLSSTVLMAPGE 134

  Fly   137 RIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYEFLQEL 200
            |||.|||.|:|:. ...:.|.:|.|..|||:.|||.|::||...::||.| ||.||::||:::|.
 Frog   135 RIKCLLQVQSVTL-KKTFQGPLDCAQTLYRELGIRGLYRGTLLTLIRDVPSTGVYFMSYEWMKEK 198

  Fly   201 AR-KKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVFRNLMATEG 264
            .| ::|:..::..|..:|:||.||:..|.:|:|.||||||.|:|||..||: |..|.|.::.:||
 Frog   199 MRGERSSARELRATEILLAGGVAGMCNWLVAIPADVLKSRFQTAPENHYKN-ILEVLREVLHSEG 262

  Fly   265 PKALFRGILPILLRAFPSTAAVFFGVELTNDLL 297
            |..|:||....:|||||:.||.|.|.|.:...|
 Frog   263 PCGLYRGFTAAMLRAFPANAACFLGFEASMSFL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 49/96 (51%)
Mito_carr 111..205 CDD:278578 41/95 (43%)
Mito_carr 208..297 CDD:278578 40/88 (45%)
slc25a20lXP_031746643.1 Mito_carr 8..105 CDD:395101 49/96 (51%)
Mito_carr 110..201 CDD:395101 40/91 (44%)
Mito_carr 215..295 CDD:395101 39/80 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6625
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 351 1.000 Inparanoid score I2219
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 1 1.000 - - mtm9345
Panther 1 1.100 - - O PTHR45624
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.