DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and slc25a47a

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001038779.1 Gene:slc25a47a / 724009 ZFINID:ZDB-GENE-060616-266 Length:294 Species:Danio rerio


Alignment Length:305 Identity:99/305 - (32%)
Similarity:145/305 - (47%) Gaps:44/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAP 82
            |:||..||.|.|.||:||||:|||:||.        .::.|:..|...|.|.||..||::|:..|
Zfish     6 FLAGSFGGACGVAVGYPLDTVKVRIQTQ--------KQFTGIWQCIVLTIRKEGVHGFFKGMFLP 62

  Fly    83 LVGVTPIYAVDFAVYAAGKRLFQTDDHIRL---TYPQIFAAGALAGVCSALVTVPTDRIKVLLQT 144
            :..::...:|.|..|   :...|...:||.   |...:|.:|...||....|..|.|.:||.||.
Zfish    63 ITTISMTSSVVFGTY---RNCLQA
LSYIRKAENTKLDVFMSGLAGGVAQVSVMSPGDIVKVRLQC 124

  Fly   145 QTVSNGPL--------LYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPT-GFYFVTYEFLQEL 200
            ||.|...:        .|:|.|.....:.|:.|:..|::|.....|||.|: ..||:||   ..|
Zfish   125 QTESRHSVNPKYSVKPKYSGPIHCLLSICREQGLSGLYRGALPLALRDGPSFATYFLTY---HTL 186

  Fly   201 ARKKSANGKIST--TSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSV--FRNLM- 260
            ..:.:.:|:...  |..:||||.||:..|.:..|.||:|:|||       ..|:|..  :|.|: 
Zfish   187 CAR
LTPDGQKEPEWTVVLLSGGVAGMSGWAVGTPMDVIKARLQ-------MDGVRGQRRYRGLLH 244

  Fly   261 ------ATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDLLKA 299
                  .|||....||.:....|||||....||...|::..:|::
Zfish   245 CLTVTTRTEGLGVFFRSLGINCLRAFPVNMVVFAVYEVSVRVLRS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 32/88 (36%)
Mito_carr 111..205 CDD:278578 32/105 (30%)
Mito_carr 208..297 CDD:278578 33/99 (33%)
slc25a47aNP_001038779.1 Mito_carr 3..77 CDD:278578 30/78 (38%)
Solcar 1 4..83 31/87 (36%)
Solcar 2 95..189 30/96 (31%)
Mito_carr 98..183 CDD:278578 27/84 (32%)
Mito_carr 196..288 CDD:278578 32/98 (33%)
Solcar 3 198..286 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.