DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and Slc25a45

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_008758401.1 Gene:Slc25a45 / 689625 RGDID:1589953 Length:292 Species:Rattus norvegicus


Alignment Length:297 Identity:109/297 - (36%)
Similarity:155/297 - (52%) Gaps:32/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFY 76
            :|..:|...|.|.|...:::|||.||:||||||..|        |:|::||..:|:|:|...||:
  Rat     4 NNSGESRQTGSVPGAVGLVLGHPFDTVKVRLQTQNT--------YQGIVDCVVKTYRHESVLGFF 60

  Fly    77 RGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRL-----TYPQIFAAGALAGVCSALVTVPTD 136
            :|:|.|:..|..:.:|.|.||:..........|...     :|..||.||...|:..|....|.|
  Rat    61 KGMSFPIASVALVNSVLFGVYSNTLLALTATSHQERRAQPPSYTNIFIAGCTGGLLQAYCLAPFD 125

  Fly   137 RIKVLLQTQT-----VSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPT-GFYFVTYE 195
            .|||.||.||     :.:....|.|.:..||.:.::.|.:.||:|:.|.:|||:|| |.||||||
  Rat   126 LIKVRLQNQTEPRMQIGSSTPRYRGPVHCAASILKEEGPQGLFRGSWALVLRDTPTLGMYFVTYE 190

  Fly   196 FLQELARKKSANGKISTTSTIL-SGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHG-----IRS 254
               .|.|:.:..|:..:::|:| :||.|||..|..|.||||:|||:|.......|:|     :.|
  Rat   191 ---GLCRQYTPEGQNPSSATVLVAGGFAGIASWITATPFDVIKSRMQMDGLKGRKYGGMLDCMAS 252

  Fly   255 VFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVE 291
            .||.    ||....|:|:.....||||..||.|...|
  Rat   253 SFRQ----EGIGVFFKGMTLNSARAFPVNAATFLSYE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 34/94 (36%)
Mito_carr 111..205 CDD:278578 39/104 (38%)
Mito_carr 208..297 CDD:278578 35/90 (39%)
Slc25a45XP_008758401.1 Mito_carr 13..81 CDD:278578 30/75 (40%)
Mito_carr 99..190 CDD:278578 35/90 (39%)
Mito_carr 201..292 CDD:278578 34/89 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.