DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and slc25a29

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001025408.1 Gene:slc25a29 / 569608 ZFINID:ZDB-GENE-050913-70 Length:305 Species:Danio rerio


Alignment Length:282 Identity:94/282 - (33%)
Similarity:138/282 - (48%) Gaps:17/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAP 82
            |:||.:||...||||||.||:|||||....    ..|.|:|...|.....|.|...|.|:||.:|
Zfish     3 FLAGCIGGAAGVLVGHPFDTVKVRLQVQSV----YKPLYRGTFHCFQSIIRQESVLGLYKGIGSP 63

  Fly    83 LVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTV 147
            ::|:|.|.|:.|.|.....|....|..:..     |.|||.||....::..|.:..|..:|.|..
Zfish    64 MMGLTFINAIVFGVQGNAMRRLGEDTPLNQ-----FLAGAAAGSIQCVICCPMELAKTRMQMQGT 123

  Fly   148 ----SNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYEFLQELARKKSAN 207
                |:...:|..::|..|::|::.|:|.:.:|....::|::| .|.||:.|:.|.. :.....:
Zfish   124 GEKKSSSRKVYKNSLDCLARIYQREGLRGVNRGMVTTLIRETPGFGVYFLAYDLLTR-SLGCEPD 187

  Fly   208 GKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQS-APEGTYKH-GIRSVFRNLMATEGPKALFR 270
            ........:.:||.:||..|....|.||:|||||: ...|.|:: .|....|..:..||.:...|
Zfish   188 DPYMIPKLLFAGGMSGIASWLSTYPVDVIKSRLQADGVGGKYQYSSIMDCTRKSIQREGFRVFTR 252

  Fly   271 GILPILLRAFPSTAAVFFGVEL 292
            |:...||||||..||.|..|.|
Zfish   253 GLTSTLLRAFPVNAATFATVTL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 36/88 (41%)
Mito_carr 111..205 CDD:278578 25/98 (26%)
Mito_carr 208..297 CDD:278578 32/87 (37%)
slc25a29NP_001025408.1 PTZ00169 2..262 CDD:240302 86/268 (32%)
Mito_carr 2..77 CDD:278578 34/77 (44%)
Mito_carr 86..183 CDD:278578 26/102 (25%)
Mito_carr 192..271 CDD:278578 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101471
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.