DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and CG7943

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:240 Identity:55/240 - (22%)
Similarity:97/240 - (40%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGIS 80
            :.|..|......|:.|.:|:..:..|......|           |..|....|:||....|||:.
  Fly    55 EEFACGCGAAFVNIAVTYPIYKMIFRQMLHGVP-----------ITSAFAQLRHEGLGFLYRGML 108

  Fly    81 APLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQ 145
            .||...|...::.|.|: .|.|.:..:|:....|.....|..:||...::: :|.:|::.||...
  Fly   109 PPLAQKTISLSIMFGVF-DGTRRYLVEDY
RLNDYGAKVLAAVVAGSAESIL-LPFERVQTLLADS 171

  Fly   146 TVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRD--SPTGFYFVTYEFLQELARKKSANG 208
            .....   ::.|.:....:....|.|.|::|......|:  |...|:.:..|....|.::||.:.
  Fly   172 KFHQH---FSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLREEASVRLPKRK
SVST 233

  Fly   209 KISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQS----APEGTYK 249
            :  |....::|...|....|:..|.:|:|..|||    ..||:::
  Fly   234 R--TVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRSEGSWQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 22/90 (24%)
Mito_carr 111..205 CDD:278578 18/95 (19%)
Mito_carr 208..297 CDD:278578 12/46 (26%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 22/92 (24%)
Mito_carr 141..229 CDD:278578 18/91 (20%)
Mito_carr 235..322 CDD:278578 12/42 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.