DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and CG1907

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:310 Identity:82/310 - (26%)
Similarity:132/310 - (42%) Gaps:51/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFY 76
            :|.:| |:.||:.||...:|..|||.:|.|:|.  :........|:..:.|.......||....|
  Fly    16 TNAIK-FLFGGLSGMGATMVVQPLDLVKTRMQI--SGAGSGKKEYRSSLHCIQTIVSKEGPLALY 77

  Fly    77 RGISAPLVGVTPIYAVDFAVYAAGKRLFQT--DDHIRLTY---PQI---FAAGALAGVCSALVTV 133
            :||.|.|:..        |.|..|:....|  :|..|..:   |.|   .|.|.:||.|.|.:..
  Fly    78 QGIGAALLRQ--------ATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGT 134

  Fly   134 PTDRIKVLLQTQTVSNGPL------LYNGTIDTAAKLYRQGGIRSLFKGTC-----ACILRDSPT 187
            |.:   |.|...| |:|.|      .|....:..|::.|:.|:.:|::|:.     |.::..:..
  Fly   135 PAE---VALVRMT-SDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQL 195

  Fly   188 GFY--FVTYEFLQELARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQS------AP 244
            ..|  |.||.....|..::..  |:...:::||    |::....::|.|:.|:|:|:      .|
  Fly   196 ASYSQFKTYFRHGPLQMEEGI--KLHFCASMLS----GLLTTITSMPLDIAKTRIQNMKMVDGKP 254

  Fly   245 EGTYKHGIRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTN 294
            |  |: |...|...:...||..||::|..|...|..|.|...|..:|..|
  Fly   255 E--YR-GTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLN 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 27/96 (28%)
Mito_carr 111..205 CDD:278578 28/112 (25%)
Mito_carr 208..297 CDD:278578 26/93 (28%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 29/103 (28%)
Mito_carr 118..207 CDD:278578 24/92 (26%)
Mito_carr 219..307 CDD:278578 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.