DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and CG5646

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651568.1 Gene:CG5646 / 43311 FlyBaseID:FBgn0039525 Length:303 Species:Drosophila melanogaster


Alignment Length:299 Identity:94/299 - (31%)
Similarity:140/299 - (46%) Gaps:43/299 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTF-RYEGFRGFYRGISA 81
            |:||..||.|.|||.||||||||          .|......|:....:.: |..|..|||||:..
  Fly     9 FVAGCFGGACGVLVAHPLDTIKV----------WQQASNSSVVTAIQQIYSRNNGVNGFYRGMFF 63

  Fly    82 PLVGVTPIYAVDFAVYAAGKRLFQT-----DDHIR--LTYPQIFAAGALAGVCSALVTVPTDRIK 139
            |.:....|.::.|.:|  |..|.|.     .|:.|  |.|..:|.||::||...:.:..|.:.||
  Fly    64 PFISTGAINSLLFGIY
--GNHLRQLRKVCHSDYQREQLEYHNMFLAGSVAGFVQSFIACPMELIK 126

  Fly   140 VLLQTQTVSNGPLLY---NGTIDTAAKLYRQGGIRSLFKGTCACILRD-SPTGFYFVTY------ 194
            |.|||.|..: ..||   .....|..::.:..||..|::|....:.|| .|.|.|.:.|      
  Fly   127 VRLQTATYYS-DYLYGQRRTAFGTFKRILKTDGISGLYRGLLPMMCRDVLPYGIYMLAYRQGVDY 190

  Fly   195 ----EFLQELARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYK---HGI 252
                :|::. .|.:|....::...|.|:|..||::.|...:||||:|:.:|:.....|:   |.:
  Fly   191 M
DRRDFVRR-RRSQSDGSSVNLLVTTLAGAWAGVISWVCVIPFDVVKTLMQADENHKYRGIFHCV 254

  Fly   253 RSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVE 291
            |..:|    ..|.:::|||...::.||.|..||.|.|.|
  Fly   255 RVQYR----AYGWRSIFRGSWMLVARAVPFNAATFLGYE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 33/94 (35%)
Mito_carr 111..205 CDD:278578 31/109 (28%)
Mito_carr 208..297 CDD:278578 28/87 (32%)
CG5646NP_651568.1 Mito_carr 5..79 CDD:395101 29/79 (37%)
Mito_carr 97..191 CDD:395101 28/94 (30%)
Mito_carr 207..294 CDD:395101 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.