DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and CG5805

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:308 Identity:69/308 - (22%)
Similarity:117/308 - (37%) Gaps:94/308 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRG--ISAPLVGVTPIYAVDFAV 96
            ||..||.:||..     .:...|||::|||.:.:|.||..|.|||  ||:..: |:.::.:  :.
  Fly    59 PLTVIKTQLQVQ-----HKSDVYKGMVDCAMKIYRSEGVPGLYRGFWISSVQI-VSGVFYI--ST 115

  Fly    97 Y----------AAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIK----VL-LQTQT 146
            |          .||.|:            :..|.|..|.:....:.||.|.|.    || :....
  Fly   116 YEGVRHVLND
LGAGHRM------------KALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHA 168

  Fly   147 VSNGPLLYNG------------TIDTAAKLYRQGGIRSLFKGTCACILRDSPT-----GFY---- 190
            .|.|.:...|            ::|...::.|:.|.|..::|..|.::...|.     .||    
  Fly   169 GSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQ 233

  Fly   191 ---------FVTYEFLQELARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEG 246
                     :|::.|:|                 .::|...|.....|..|.|::::|||     
  Fly   234 DELFR
ICPVWVSHLFIQ-----------------CVAGSLGGFTTTILTNPLDIVRARLQ----- 276

  Fly   247 TYKHGIRSV---FRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVE 291
              .|.:.|:   ||.|...|.....|:|:...|:::...:.::..|.|
  Fly   277 --VHRLDSMSVAFRELWQEEKLNCFFKGLSARLVQSAAFSFSIILGYE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 26/84 (31%)
Mito_carr 111..205 CDD:278578 24/128 (19%)
Mito_carr 208..297 CDD:278578 19/87 (22%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 23/73 (32%)
Mito_carr 132..238 CDD:395101 21/117 (18%)
Mito_carr 245..327 CDD:395101 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.