DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and DPCoAC

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:298 Identity:77/298 - (25%)
Similarity:126/298 - (42%) Gaps:19/298 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EKKSNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFR 73
            :|....|.|.|:|...|.....|..|||..|:..|.....|..    ::..:.....|:..||..
  Fly    67 QKIDQVVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFS----FRASLRYLQNTYANEGVL 127

  Fly    74 GFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRI 138
            ..:||.||.:..:.|..|:.|..:...:|:...|.....|..:.|.||:|||:.|..:|.|.|..
  Fly   128 ALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLA 192

  Fly   139 KVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYEFLQELAR 202
            :..:.......|   |........|::.:.|.|:||:|..|.:|...| .|..|.|||.|:....
  Fly   193 RARMAVTDRYTG---YRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYY 254

  Fly   203 KKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGT-----YKHGIRSVFRNLMAT 262
            :...|.|.:|..::..|..||....|.:.|.|:::.|:|:....|     |...:.::.: :...
  Fly   255 EVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVK-IYRE 318

  Fly   263 EGPK-ALFRGILPILLRAFPSTAAVFFGVELTNDLLKA 299
            ||.| ..::|:....::. |....:.|.   |.||:||
  Fly   319 EGVKNGFYKGLSMNWIKG-PIAVGISFS---TYDLIKA 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 24/96 (25%)
Mito_carr 111..205 CDD:278578 28/94 (30%)
Mito_carr 208..297 CDD:278578 20/94 (21%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 23/90 (26%)
Mito_carr 169..251 CDD:278578 27/84 (32%)
Mito_carr 279..356 CDD:278578 18/79 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.