DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and Dic1

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:300 Identity:84/300 - (28%)
Similarity:126/300 - (42%) Gaps:51/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EKKSNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFR 73
            |:||    .:..||:..:...:|.||||.|||.|||.        ..:..|.....:..|.:|..
  Fly     5 ERKS----MWFFGGLASVGAAMVTHPLDLIKVTLQTQ--------QGHLSVAQLIPKLAREQGVL 57

  Fly    74 GFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRI 138
            .||.|:||.::.........|.||.|||:...||..    ..::..||| :|:...:|..|.|.:
  Fly    58 VFYNGLSASVLRQLTYSTARFGVYEAGKKYVNTDSF----GGKVALAGA-SGLVGGIVGTPADMV 117

  Fly   139 KVLLQT------QTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRD-----------SP 186
            .|.:|.      |...|    ||...|...::|||.|.:.||.|..|...|.           ..
  Fly   118 NVRMQNDVKLPPQQRRN----YNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQ 178

  Fly   187 TGFYFVTYEFLQELARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHG 251
            |..|.:...:.|:       |.....|::::    ||.:..||..|.||||:|..:|..|.: :|
  Fly   179 TKIYLLATPYFQD-------NLVTHFTASLV----AGTIATTLTQPLDVLKTRSMNAKPGEF-NG 231

  Fly   252 IRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVE 291
            :..:.:: .|..||...|:|.:|..:|..|.|...|..:|
  Fly   232 LWDIVKH-TAKLGPLGFFKGYVPAFVRLGPHTIITFVFLE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 29/96 (30%)
Mito_carr 111..205 CDD:278578 26/110 (24%)
Mito_carr 208..297 CDD:278578 24/83 (29%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 28/89 (31%)
PTZ00169 13..273 CDD:240302 80/287 (28%)
Mito_carr 89..184 CDD:278578 27/103 (26%)
Mito_carr 189..278 CDD:278578 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.