DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and GC2

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:334 Identity:93/334 - (27%)
Similarity:148/334 - (44%) Gaps:54/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEVEISTEKKSNPVK-----SFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVI 60
            :|:||...:::..|.|     ..|.|||.|:..|...:|||.:|.|||.....|.|: ..|..:.
  Fly     2 LEQVEQKNQEQKKPQKFNVFPKIINGGVAGIIGVACVYPLDMVKTRLQNQTIGPNGE-RMYTSIA 65

  Fly    61 DCAARTFRYEGFRGFYRGISAPLVGVTPIYAV-----DFAVYAAGKRLFQTDDHIRLTYPQIFAA 120
            ||..:|...||:.|.|||.:..:|.:||..|:     ||..|    .|...|..|.|:...:  |
  Fly    66 DCFRKTIASEGYFGMYRGSAVNIVLITPEKAIKLTANDFFRY----HLASDDGVIPLSRATL--A 124

  Fly   121 GALAGVCSALVTVPTDRIKVLLQ---------------TQTVSNGPLLYNGTIDTAAKLYRQGGI 170
            |.|||:...:||.|.:.:|:.:|               .:|::        .:.....|.|:.||
  Fly   125 GGLAGLFQIVVTTPMELLKIQMQDAGRVAAADRAAGREVKTIT--------ALGLTKTLLRERGI 181

  Fly   171 RSLFKGTCACILRDSPTGF-YFVTYEFLQELA-RKKSANGKISTTSTILSGGTAGIVFWTLAVPF 233
            ..|:||..|..:||..... ||....::.:.. ||...:|:.....::::|..:|:....:..||
  Fly   182 FGLYKGVGATGVRDITFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPF 246

  Fly   234 DVLKSRLQSAPEGTYKHGIRSVFRNLMATEGPKALFRGILPILLRAFP--STAAVFF-------- 288
            ||:|:|||:..|..:| ||.......:..||..|.|:|.|..::...|  ..|.:|:        
  Fly   247 DVVKTRLQADGEKKFK-GIMDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGVGEKI 310

  Fly   289 -GVELTNDL 296
             |:|.|..:
  Fly   311 LGIERTKSV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 35/106 (33%)
Mito_carr 111..205 CDD:278578 26/110 (24%)
Mito_carr 208..297 CDD:278578 27/100 (27%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 84/290 (29%)
Mito_carr 16..106 CDD:278578 32/90 (36%)
Mito_carr 123..203 CDD:278578 21/89 (24%)
Mito_carr 228..302 CDD:278578 22/74 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441751
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.