DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and CG2616

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:349 Identity:82/349 - (23%)
Similarity:131/349 - (37%) Gaps:83/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TEKKSN-------------PVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTP----------- 48
            |:.||:             |::..|:...|.|.......|||.||.|:|:..:|           
  Fly    71 TDSKSSHRKLLSDPRFQIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGL 135

  Fly    49 --------PPG-------QPPRYKGVIDCAARTFRYEGFRGFYRGISAPLVGVTPIYAVDFAVYA 98
                    |.|       |.|::....|...:..|:||....:.|:...||...|...:.|..|.
  Fly   136 MDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYE 200

  Fly    99 AGKRLF-----------QTDDHIRL-----TYPQI--FAAGALAGVCSALVTVPTDRIKVLLQTQ 145
            ..|..:           |...|:.:     :.|.:  ..:|..|.:|:..|..|.:.::..:|.|
  Fly   201 QFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ 265

  Fly   146 TVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYEFL-QELARKKSANG 208
            ..:     |...:.....:....|:..|::|....||||.| :|.|:..||.| |.|......:.
  Fly   266 RQT-----YAQMLQFVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSF 325

  Fly   209 KISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQ----------SAPEGTYKHGIRSVFRNLMA-- 261
            .:|..:.:::|..|.||    ..||||:|:..|          .:|...:  |.:|.|..|..  
  Fly   326 SLSFLAGVMAGTVAAIV----TTPFDVVKTHEQIEFGERVIFTDSPARDF--GKKSTFSRLTGIY 384

  Fly   262 -TEGPKALFRGILPILLRAFPSTA 284
             |.|.:.||.|..|.||:..|:.|
  Fly   385 RTHGVRGLFAGCGPRLLKVAPACA 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 30/146 (21%)
Mito_carr 111..205 CDD:278578 24/102 (24%)
Mito_carr 208..297 CDD:278578 26/90 (29%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 27/120 (23%)
Mito_carr 230..321 CDD:278578 24/95 (25%)
Mito_carr 321..425 CDD:278578 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.