DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and Bmcp

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:324 Identity:83/324 - (25%)
Similarity:128/324 - (39%) Gaps:71/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQ-------PPRYKGVIDCAARTFRYEGFR 73
            :.|:.|||..:.......|:||.|.|||..     ||       ..||:|:.|...:..|.||.|
  Fly     8 RPFVYGGVASITAEFGTFPIDTTKTRLQIQ-----GQKIDQSFSQLRYRGMTDAFVKISREEGLR 67

  Fly    74 GFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQ------TDDHIRLTYPQIFAAGALAGVCSALVT 132
            ..|.||...::.......:.|..|...|:|..      .:|.....:..|..|.| ||..|:.:.
  Fly    68 ALYSGIWPAVLRQATYGTIKFGTYYTLKKL
ANERGLLINEDGSERVWSNILCAAA-AGAISSAIA 131

  Fly   133 VPTDRIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTGFYFV----- 192
            .|||.:||.:|.    :|...:.|.:....::|:..|:|.|::|.       .||....|     
  Fly   132 NPTDVLKVRMQV----HGKGQHKGLLGCFGEIYKYEGVRGLWRGV-------GPTAQRAVVIASV 185

  Fly   193 ---TYEF--LQELARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQS-APEGTYKHG 251
               .|:|  ||.:.......|....:|.|.|.|:|     ..:.|.||:::||.: .|.....:|
  Fly   186 ELPVYDFCKLQLMNAFGDHVGNHFISSFIASLGSA-----IASTPIDVIRTRLMNQRPVSITMNG 245

  Fly   252 IRS-----------------VFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDLLK 298
            :.:                 ..||    ||..||::|.:|..:|..|.. .:||   :|.:.||
  Fly   246 VVTAAATPKLYSGSLDCAVQTIRN----EGLPALYKGFIPTWVRMGPWN-IIFF---ITYEQLK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 28/103 (27%)
Mito_carr 111..205 CDD:278578 26/103 (25%)
Mito_carr 208..297 CDD:278578 26/106 (25%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 27/93 (29%)
Mito_carr <132..199 CDD:278578 20/77 (26%)
Mito_carr 204..303 CDD:278578 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441765
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.