DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and sea

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:287 Identity:80/287 - (27%)
Similarity:120/287 - (41%) Gaps:14/287 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGI 79
            :|..:|||:.|...:.:.:|.:.:|.:||   ....|...:|.|:.||..:|....||.|.|||:
  Fly    34 LKGIVAGGITGGIEICITYPTEYVKTQLQ---LDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGL 95

  Fly    80 SAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTV-PTDRIKVLLQ 143
            |..:.|..|..|..|..:...|. ...|...:|:.......|..||||.|:|.| |.:.|||...
  Fly    96 SVLVYGSIPKSAARFGAFEFLKS-NAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFI 159

  Fly   144 TQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRD-SPTGFYFVTYEFLQELARKKSAN 207
            ....|..| .:.|......::.:..||..::||....||:. |.....|...|.|::|.:.....
  Fly   160 NDQRSGNP-KFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDDHT 223

  Fly   208 GKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYK---HGIRSVFRNLMATEGPKALF 269
            ..:......:.|..||........|.||:|:|:|......||   |....:.:|    |||.|.:
  Fly   224 KPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKN----EGPAAFY 284

  Fly   270 RGILPILLRAFPSTAAVFFGVELTNDL 296
            :|.:|.|.|.....|..|...:...||
  Fly   285 KGTVPRLGRVCLDVAITFMIYDSFMDL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 27/91 (30%)
Mito_carr 111..205 CDD:278578 27/95 (28%)
Mito_carr 208..297 CDD:278578 25/92 (27%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 77/276 (28%)
Mito_carr 34..117 CDD:278578 26/85 (31%)
Mito_carr 125..220 CDD:278578 27/95 (28%)
Mito_carr 235..314 CDD:278578 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.