DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and Dic3

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:284 Identity:82/284 - (28%)
Similarity:120/284 - (42%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GGMCNVLV---GHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAPLVG 85
            ||:|..:.   .||:|.|||:|||.     .|..| |.|.:.........|..|||.||||....
  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQ-----SQADR-KTVGEILKGIHERSGILGFYNGISASWFR 73

  Fly    86 VTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSNG 150
            ........||:|.|||....|.     ......|....||:...:|.||.|.:.|.||     |.
  Fly    74 QLTYTTTRFALYEAGKDYVDTQ-----KVSSKMALATFAGIVGGIVGVPGDVVTVRLQ-----ND 128

  Fly   151 PLL-------YNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTGFYFVT------YEFLQELAR 202
            ..|       |....|...::|::.|:.|||:||...:.|     ...:|      |:.::::.:
  Fly   129 VKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSR-----AVLLTIGTNAAYDQVKQMLK 188

  Fly   203 KKSANGK----ISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVFRNLMATE 263
            ..:..|:    ...||||     ||.:...:..|.||:|:...:|..|.:. ||...|.: .|.:
  Fly   189 IATGAGEGVPLHFATSTI-----AGCIAVVITQPLDVIKTTFMNAQPGEFS-GIGGAFLS-TAKQ 246

  Fly   264 GPKALFRGILPILLRAFPSTAAVF 287
            ||.|.::|.:|.|:|..|:|...|
  Fly   247 GPLAFYKGFIPALIRVSPNTIITF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 30/85 (35%)
Mito_carr 111..205 CDD:278578 24/106 (23%)
Mito_carr 208..297 CDD:278578 27/84 (32%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 82/284 (29%)
Mito_carr 15..91 CDD:278578 30/81 (37%)
Mito_carr 93..187 CDD:278578 25/108 (23%)
Mito_carr 200..281 CDD:278578 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.