DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and CG4995

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:303 Identity:114/303 - (37%)
Similarity:156/303 - (51%) Gaps:29/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STEKKSNP--VKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRY 69
            :|.:..:|  |..|:||.:||...||||||.||:||.|||    ...:.|:|||...|.....:.
  Fly    31 ATSETFSPKMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQT----DDPRNPKYKGTFHCFRTIVQR 91

  Fly    70 EGFRGFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVP 134
            :.|.|.|||||:|:.|:..:.|:.|.||...:||  ::|...||  ..|.||::|||....|..|
  Fly    92 DKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRL--SNDPNSLT--SHFFAGSIAGVAQGFVCAP 152

  Fly   135 TDRIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTGF--YFVTYEFL 197
            .:..|..||..|..:..:.:.|.|.....:.:..|||..|||..|.||||.| ||  |||::|:|
  Fly   153 MELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIP-GFASYFVSFEYL 216

  Fly   198 QELARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGT---YKHGIRSV---F 256
            .   |:....|   ...|:::||.||:..|....|.||:|:.:|:...|.   |...|...   |
  Fly   217 M---RQVETPG---VAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGF 275

  Fly   257 RNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDLLKA 299
            ||    |||:..|||:...|:||||..||.||.|....|:..|
  Fly   276 RN----EGPQYFFRGLNSTLIRAFPMNAACFFVVSWVLDICNA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 40/98 (41%)
Mito_carr 111..205 CDD:278578 36/95 (38%)
Mito_carr 208..297 CDD:278578 35/94 (37%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 38/92 (41%)
PTZ00169 41..295 CDD:240302 102/272 (38%)
Mito_carr 128..218 CDD:278578 36/95 (38%)
Mito_carr 221..304 CDD:278578 32/89 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441384
Domainoid 1 1.000 66 1.000 Domainoid score I2789
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1238
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101471
Panther 1 1.100 - - P PTHR45624
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.