DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and colt

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:290 Identity:182/290 - (62%)
Similarity:226/290 - (77%) Gaps:1/290 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ISTEKKSNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYE 70
            :|||:|:||||||:.||.||:||||.|||||||||||||||.|.||:.|.|:|..||||:|.:.|
  Fly     7 VSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNE 71

  Fly    71 GFRGFYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPT 135
            |.||.|:|:||||.||.||:|:.||.||.||||.|..:..:|||||||.||:.:|:.|.|:..|.
  Fly    72 GVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPG 136

  Fly   136 DRIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYEFLQE 199
            :|||||||||....|...|||.||.|.|||::||:||:|||:||.:|||.| .|.||:.||.||:
  Fly   137 ERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQD 201

  Fly   200 LARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVFRNLMATEG 264
            :|:.||..|:|||.|||.:||.||:.:|.|.:|.|||||||||||||||||||||||::|:..:|
  Fly   202 VAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKDG 266

  Fly   265 PKALFRGILPILLRAFPSTAAVFFGVELTN 294
            |.||:||:.||:|||||:.||.|||:||.|
  Fly   267 PLALYRGVTPIMLRAFPANAACFFGIELAN 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 65/96 (68%)
Mito_carr 111..205 CDD:278578 53/94 (56%)
Mito_carr 208..297 CDD:278578 59/87 (68%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 64/94 (68%)
Mito_carr 112..202 CDD:395101 52/89 (58%)
Mito_carr 210..299 CDD:395101 59/87 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446245
Domainoid 1 1.000 88 1.000 Domainoid score I2715
eggNOG 1 0.900 - - E1_KOG0758
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I1379
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 1 1.000 - - mtm6581
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45624
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 1 1.000 - - X2353
1110.930

Return to query results.
Submit another query.