DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and Rim2

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:336 Identity:77/336 - (22%)
Similarity:121/336 - (36%) Gaps:80/336 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IAGGVGGMCNVLVGHPLDTIKVRLQTMPT--------------PPPG------------------ 51
            ||||..|....:|..||:.:|.|||:...              |..|                  
  Fly    13 IAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQRRKLSTTI 77

  Fly    52 -----QP---------------------PRYKGVIDCAARTFRYEGFRGFYRGISAPLVGVTPIY 90
                 ||                     |:...::.|.....:.||.|..::|:...||||.|..
  Fly    78 LRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPSR 142

  Fly    91 AVDFAVYAAGKRLFQTDDHIRLTYPQI-FAAGALAGVCSALVTVPTDRIKVLLQTQTVSNGPLLY 154
            |:.|..|:..|....:...:....|.: ..:.|.||..|:..|.|...:|..:|        |.|
  Fly   143 AIYFCTYSQTKNTL
NSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQ--------LDY 199

  Fly   155 NGTIDTAA-----KLYRQGGIRSLFKGTCACILRDSPTGFYFVTYEFL------QELARKKSANG 208
            |..:....     ::|.|||:.:.:||..|.......|..:||.|||:      |...|.....|
  Fly   200 NSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGICETMVHFVIYEFIKSKLLE
QRNQRHTDTKG 264

  Fly   209 KISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVFRNLMATEGPKALFRGIL 273
            .......:::|..:..:...:|.|.:|.::||:.  ||...:........:...||...|:||:.
  Fly   265 SRDFLEFMMAGAVSKTIASCIAYPHEVARTRLRE--EGNKYNSFWQTLHTVWKEEGRAGLYRGLA 327

  Fly   274 PILLRAFPSTA 284
            ..|:|..|:||
  Fly   328 TQLVRQIPNTA 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 31/145 (21%)
Mito_carr 111..205 CDD:278578 27/105 (26%)
Mito_carr 208..297 CDD:278578 19/77 (25%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 31/142 (22%)
Mito_carr 163..253 CDD:278578 25/97 (26%)
Mito_carr 268..355 CDD:278578 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441767
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.