DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and sesB

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:279 Identity:74/279 - (26%)
Similarity:118/279 - (42%) Gaps:23/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPR-YKGVIDCAARTFRYEGFRGFYRG 78
            ||.|.|||:....:.....|::.:|:.||.........|.: |||::||..|..:.:||..|:||
  Fly    24 VKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRG 88

  Fly    79 ISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIF----AAGALAGVCSALVTVPTDRIK 139
            ..|.::...|..|::||.....|::|.........:.:.|    |:|..||..|.....|.|..:
  Fly    89 NLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFAR 153

  Fly   140 VLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKG-----TCACILRDSPTGFYFVTYEFLQE 199
            ..|...|...|...:.|..:...|:::..||..|::|     ....|.|.:..|||......|.:
  Fly   154 TRLAADTGKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPD 218

  Fly   200 LARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRL-----QSAPEGTYKHGIRSVFRNL 259
               .|:....||.....:....||||    :.|||.::.|:     :.|.|..||:.:. .:..:
  Fly   219 ---PKNTPIYISWAIAQVVTTVAGIV----SYPFDTVRRRMMMQSGRKATEVIYKNTLH-CWATI 275

  Fly   260 MATEGPKALFRGILPILLR 278
            ...||..|.|:|....:||
  Fly   276 AKQEGTGAFFKGAFSNILR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 29/92 (32%)
Mito_carr 111..205 CDD:278578 23/102 (23%)
Mito_carr 208..297 CDD:278578 21/76 (28%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 29/91 (32%)
PTZ00169 23..312 CDD:240302 74/279 (27%)
Mito_carr 124..220 CDD:278578 23/98 (23%)
Mito_carr 223..312 CDD:278578 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441756
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.