DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and CG1628

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:304 Identity:102/304 - (33%)
Similarity:146/304 - (48%) Gaps:41/304 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEG-FRGFYRGISA 81
            |:||.:||...|.|..||||:||:|||.       |..|:|::||...|:|.:| .||.|.| |.
  Fly   173 FLAGSLGGAAQVYVSQPLDTVKVKLQTF-------PEAYRGMLDCFLSTYRKDGVLRGLYAG-SV 229

  Fly    82 PLVGV-----TPIYAV-----DFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTD 136
            |.|..     :.::|.     .|..:..||.  ...|   ||..|...||:||...|.|...||:
  Fly   230 PAVFANVAENSVLFAAYGGCQKFVAFCVGKE--TAGD---LTTVQNACAGSLAACFSTLTLCPTE 289

  Fly   137 RIKVLLQT-QTVSN-----GPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTGFYFV-TY 194
            .||..||. :.:.|     .|............::|..|||..::|..:..||:.|..|:|. :|
  Fly   290 LIKCKLQALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFGSY 354

  Fly   195 EFLQELARK-KSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVF-- 256
            |..:||.|: ..:...|....|:::|...|:..||...|.||:|||:|      .|:...|:|  
  Fly   355 EGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQ------VKNLNESMFAV 413

  Fly   257 -RNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDLLKA 299
             .:::..||..||:||:||.:||..|:||.:|...|.|...|.|
  Fly   414 GADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKRALSA 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 35/99 (35%)
Mito_carr 111..205 CDD:278578 32/101 (32%)
Mito_carr 208..297 CDD:278578 32/91 (35%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 100/300 (33%)
Mito_carr 170..252 CDD:278578 32/86 (37%)
Mito_carr 263..364 CDD:278578 33/103 (32%)
Mito_carr 369..455 CDD:278578 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.