DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and Slc25a29

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_006240603.1 Gene:Slc25a29 / 314441 RGDID:1308104 Length:310 Species:Rattus norvegicus


Alignment Length:257 Identity:88/257 - (34%)
Similarity:130/257 - (50%) Gaps:16/257 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAPLVGVTPIYAVDFAVYAA 99
            |...:||||...|    :.|:|:|.:.|.....:.|...|.|:|:.:||:|:|.|.|:.|.|...
  Rat    26 LTETEVRLQVQNT----EKPQYRGTLHCFQSIIKQESVLGLYKGLGSPLMGLTFINALVFGVQGN 86

  Fly   100 GKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSNGPL-LYNGTIDTAAK 163
            ..|....|..:..     |.|||.||....::..|.:..|..||.|..  ||. .|.|::|...:
  Rat    87 TLRALGQDSPLNQ-----FLAGAAAGAIQCVICCPMELAKTRLQLQAA--GPARAYKGSLDCLVQ 144

  Fly   164 LYRQGGIRSLFKGTCACILRDSPT-GFYFVTYEFLQELARKKSANGKISTTSTILSGGTAGIVFW 227
            :||..|:|.:.:|..:.:||::|: |.||:||:.|.. |.......::.....:|:|||:||..|
  Rat   145 IYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVLTR-AMGCEPGDRLLVPKLLLAGGTSGITSW 208

  Fly   228 TLAVPFDVLKSRLQS-APEGTYKH-GIRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVF 287
            ....|.||:|||||: ..:||.:: ||....|.....||.:...||:...||||||..||.|
  Rat   209 LSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQAEGWQVFTRGLASTLLRAFPVNAATF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 23/71 (32%)
Mito_carr 111..205 CDD:278578 31/95 (33%)
Mito_carr 208..297 CDD:278578 33/82 (40%)
Slc25a29XP_006240603.1 Mito_carr <31..83 CDD:278578 20/55 (36%)
Mito_carr 92..179 CDD:278578 30/93 (32%)
Mito_carr 189..272 CDD:278578 33/82 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101471
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.