DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and Slc25a15

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001041345.1 Gene:Slc25a15 / 306574 RGDID:1311488 Length:338 Species:Rattus norvegicus


Alignment Length:340 Identity:100/340 - (29%)
Similarity:156/340 - (45%) Gaps:63/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KSNP-VKSFI---AGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEG 71
            |||| :::.|   ||..||...||.|.|.||:||::||.       |..|:|:.||..||:...|
  Rat     2 KSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTF-------PDLYRGLTDCCLRTYSQVG 59

  Fly    72 FRGFYRGISAPLVGVTPIYAVDFAVYA----AGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVT 132
            |||||:|.|..|:......:|.|..|.    ..:::...|...:|:..|..|||:.|...:|||.
  Rat    60 FRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVVGLDRQAKLSDLQNAAAGSFASAFAALVL 124

  Fly   133 VPTDRIKVLLQT--QTVSNGPLL--YNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTGFYFVT 193
            .||:.:|..|||  :..::|.:.  .|.......:::|:.|....:.|..:.:||:.| |::|..
  Rat   125 CPTELVKCRLQTMYEMETSGKIAASQNTVWSVVKEIFRKDGPLGFYHGLSSTLLREVP-GYFFFF 188

  Fly   194 YEFLQELARKKSANGK----ISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRS 254
            ..:  ||:|...|:|:    :.....:||||..||..|....|.|.:|||:|.......:.|:..
  Rat   189 GGY--ELSRSFFASGRSKDELGPIPLMLSGGFGGICLWLAVYPVDCIKSRIQVLSMTGKQTGLIR 251

  Fly   255 VFRNLMATEG----------------PK---------------------ALFRGILPILLRAFPS 282
            .|.:::..||                ||                     ||:.|:.|.::||||:
  Rat   252 TFLSIVKNEGGYRLSESRLYDVSFVQPKTCLSGVHYVGILKLGLREGITALYSGLKPTMIRAFPA 316

  Fly   283 TAAVFFGVELTNDLL 297
            ..|:|...|.:..|:
  Rat   317 NGALFLAYEYSRKLM 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 38/103 (37%)
Mito_carr 111..205 CDD:278578 28/97 (29%)
Mito_carr 208..297 CDD:278578 31/129 (24%)
Slc25a15NP_001041345.1 Mito_carr 9..94 CDD:395101 34/91 (37%)
Mito_carr <122..198 CDD:395101 21/78 (27%)
Mito_carr 205..332 CDD:395101 31/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.