DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and SPAC4G9.20c

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_593701.2 Gene:SPAC4G9.20c / 2543680 PomBaseID:SPAC4G9.20c Length:298 Species:Schizosaccharomyces pombe


Alignment Length:294 Identity:91/294 - (30%)
Similarity:147/294 - (50%) Gaps:15/294 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFY 76
            |...|.|:||..||:..||||.|.|.:|||||:.    ....|.|...:||..:..:.||...||
pombe    11 SQSTKDFLAGVSGGVAQVLVGQPFDCVKVRLQSQ----SNVSPIYNNALDCVKKISKNEGLAAFY 71

  Fly    77 RGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVL 141
            :|...||:|:....::.|..:...||.|..|. ..:|.||.:.:||::|:.::.:..|.:.:::.
pombe    72 KGTVLPLLGIGFCVSIQFTTFEYCKRFFSRDG-TPVTMPQYYVSGAISGLANSFLVGPVEHVRIR 135

  Fly   142 LQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDS-PTGFYFVTYEFLQELARKKS 205
            ||.||..|  :||:|..|...|:..|.|:..:.||......|:: ..|.||:.||.|.:....|.
pombe   136 LQIQTGKN--VLYHGPWDCIKKISSQYGLSGIMKGYNPTAAREAHGLGMYFLAYEALVKNTMAKH 198

  Fly   206 ANGKISTT---STILSGGTAGIVFWTLAVPFDVLKSRLQS---APEGTYKHGIRSVFRNLMATEG 264
            .....|.|   ...:.|..||...|..|.|||::||::|:   ..:.|||:..:.. :.:....|
pombe   199 HLTDRSQTPGWKLCVFGAGAGYAMWLAAYPFDIVKSKIQTDGFLSKATYKNSWQCA-KGIYTKAG 262

  Fly   265 PKALFRGILPILLRAFPSTAAVFFGVELTNDLLK 298
            .:..:||.:|:|:||.|:.|..|:..|..:..::
pombe   263 LRGFYRGFVPVLVRAAPANAVTFYVYETVSQHIR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 34/94 (36%)
Mito_carr 111..205 CDD:278578 28/94 (30%)
Mito_carr 208..297 CDD:278578 27/94 (29%)
SPAC4G9.20cNP_593701.2 PTZ00169 15..286 CDD:240302 88/278 (32%)
Mito_carr 15..103 CDD:278578 33/91 (36%)
Mito_carr 105..198 CDD:278578 28/94 (30%)
Mito_carr 204..297 CDD:278578 27/94 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I2789
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1238
OMA 1 1.010 - - QHG54095
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101471
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.