DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and SLC25A48

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_006714607.1 Gene:SLC25A48 / 153328 HGNCID:30451 Length:320 Species:Homo sapiens


Alignment Length:234 Identity:71/234 - (30%)
Similarity:107/234 - (45%) Gaps:35/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGI 79
            ::.|.||.:||..:|:|||||||:|.|||.        ...|...:.|....:|.|...||::|:
Human     6 LEDFAAGWIGGAASVIVGHPLDTVKTRLQA--------GVGYGNTLSCIRVVYRRESMFGFFKGM 62

  Fly    80 SAPLVGVTPIYAVDFAVYAAGKRLF------QTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRI 138
            |.||..:....:|.|.|::..:|..      :.:.....|...:..|..:|||.|..:..|.|.|
Human    63 SFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGLGGPVDLI 127

  Fly   139 KVLLQTQT----------------VSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPT 187
            |:.||.||                .:..| .|.|.:.....:.|..|:..|::|..|.:|||.| 
Human   128 KIRLQMQTQPFRDANLGLKSRAVAPAEQP-AYQGPVHCITTIVRNEGLAGLYRGASAMLLRDVP- 190

  Fly   188 GF--YFVTYEFLQELARKKSANGKISTTSTILSGGTAGI 224
            |:  ||:.|.||.|....::..|. |..:..|:||.||:
Human   191 GYCLYFIPYVFLSEWITPEACTGP-SPCAVWLAGGMAGV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 31/97 (32%)
Mito_carr 111..205 CDD:278578 33/111 (30%)
Mito_carr 208..297 CDD:278578 7/17 (41%)
SLC25A48XP_006714607.1 Mito_carr 6..91 CDD:278578 31/92 (34%)
Mito_carr 107..207 CDD:278578 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.