DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and SLC25A29

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001339750.1 Gene:SLC25A29 / 123096 HGNCID:20116 Length:356 Species:Homo sapiens


Alignment Length:270 Identity:97/270 - (35%)
Similarity:138/270 - (51%) Gaps:22/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAPLVGVTPI 89
            |:..||||||.||:|||||....    :.|:|:|.:.|.....:.|...|.|:|:.:||:|:|.|
Human    65 GVAGVLVGHPFDTVKVRLQVQSV----EKPQYRGTLHCFKSIIKQESVLGLYKGLGSPLMGLTFI 125

  Fly    90 YAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSNGPL-L 153
            .|:.|.|.....|....|..:..     |.|||.||....::..|.:..|..||.|..  ||. .
Human   126 NALVFGVQGNTLRALGHDSPLNQ-----FLAGAAAGAIQCVICCPMELAKTRLQLQDA--GPART 183

  Fly   154 YNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPT-GFYFVTYEFLQELARKKSANGKISTTSTIL 217
            |.|::|..|::|...|:|.:.:|..:.:||::|: |.||:||:.|.. |.......::.....:|
Human   184 YKGSLDCLAQIYGHEGLRGVNRGMVSTLLRETPSFGVYFLTYDALTR-ALGCEPGDRLLVPKLLL 247

  Fly   218 SGGTAGIVFWTLAVPFDVLKSRLQS-----APEGTYKHGIRSVFRNLMATEGPKALFRGILPILL 277
            :|||:|||.|....|.||:|||||:     ||.  |: ||..........||.:...||:...||
Human   248 AGGTSGIVSWLSTYPVDVVKSRLQADGLRGAPR--YR-GILDCVHQSYRAEGWRVFTRGLASTLL 309

  Fly   278 RAFPSTAAVF 287
            ||||..||.|
Human   310 RAFPVNAATF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 31/81 (38%)
Mito_carr 111..205 CDD:278578 31/95 (33%)
Mito_carr 208..297 CDD:278578 34/85 (40%)
SLC25A29NP_001339750.1 Mito_carr 65..132 CDD:278578 29/70 (41%)
Mito_carr 141..233 CDD:278578 32/99 (32%)
Mito_carr 238..321 CDD:278578 34/85 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101471
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.