DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and Slc25a20

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_446417.2 Gene:Slc25a20 / 117035 RGDID:621443 Length:301 Species:Rattus norvegicus


Alignment Length:291 Identity:142/291 - (48%)
Similarity:193/291 - (66%) Gaps:5/291 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKSNPVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRG 74
            |..:|:|:.:|||.||:|.|.|||||||:||||||.|...|||||.|.|.|||..:|...||..|
  Rat     6 KPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTIDCFRKTLFREGITG 70

  Fly    75 FYRGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIK 139
            .|||::||::||||::||.|..:..||||.|......|||||:|.||.|:||.:..:..|.:|||
  Rat    71 LYRGMAAPIIGVTPMFAVCFFGFGLGKRLQQKSPEDELTYPQLFTAGMLSGVFTTGIMTPGERIK 135

  Fly   140 VLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYFVTYEFLQEL--A 201
            .|||.| .|:|...|:||:|.|.|||::.|||..:|||...::||.| :|.||:|||:|:.|  .
  Rat   136 CLLQIQ-ASSGKNKYSGTLDCAKKLYQEFGIRGFYKGTVLTLMRDVPASGMYFMTYEWLKNLFTP 199

  Fly   202 RKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVFRNLMATEGPK 266
            :.||.: .:|....:::||.|||..|.:|:|.||||||.|:||.|.|.:|.|.|.|.|:..||..
  Rat   200 QGKSVH-DLSVPRVLVAGGFAGIFNWVVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIREEGVT 263

  Fly   267 ALFRGILPILLRAFPSTAAVFFGVELTNDLL 297
            :|::|...:::||||:.||.|.|.|:...:|
  Rat   264 SLYKGFNAVMIRAFPANAACFLGFEIAMKIL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 55/96 (57%)
Mito_carr 111..205 CDD:278578 46/96 (48%)
Mito_carr 208..297 CDD:278578 38/88 (43%)
Slc25a20NP_446417.2 Mito_carr 6..103 CDD:278578 55/96 (57%)
Solcar 1 8..99 51/90 (57%)
PTZ00169 11..277 CDD:240302 131/267 (49%)
Mito_carr 106..198 CDD:278578 46/92 (50%)
Solcar 2 108..196 45/88 (51%)
Mito_carr 206..294 CDD:278578 38/87 (44%)
Solcar 3 207..293 38/85 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I4930
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 328 1.000 Inparanoid score I2381
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 1 1.000 - - otm44491
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45624
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2353
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.