DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and Slc25a45

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001348902.1 Gene:Slc25a45 / 107375 MGIID:2147731 Length:288 Species:Mus musculus


Alignment Length:295 Identity:112/295 - (37%)
Similarity:158/295 - (53%) Gaps:32/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PVKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRG 78
            ||:.|:||.:.|...:::|||.||:||||||..|        |:|::||..:|:|:|...||::|
Mouse     2 PVEEFVAGWISGAVGLVLGHPFDTVKVRLQTQST--------YQGIVDCVVKTYRHESVLGFFKG 58

  Fly    79 ISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRL-----TYPQIFAAGALAGVCSALVTVPTDRI 138
            :|.|:..|..:.:|.|.||:..........|...     :|..||.||...|:..|....|.|.|
Mouse    59 MSFPIASVALVNSVLFGVYSNTLLA
LTATSHQERRAQPPSYTNIFIAGCTGGLLQAYCLAPFDLI 123

  Fly   139 KVLLQTQT-----VSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPT-GFYFVTYEFL 197
            ||.||.||     :|:....|.|.:..||.:.|:.|.:.||:|:.|.:|||:|| |.||||||  
Mouse   124 KVRLQNQTEPRMQISSSMPRYRGPVHCAASILREEGPQGLFRGSWALVLRDTPTLGMYFVTYE-- 186

  Fly   198 QELARKKSANGKISTTSTIL-SGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHG-----IRSVF 256
             .|.|:.:..|:..:::|:| :||.|||..|..|.||||:|||:|.......|:|     :.|.|
Mouse   187 -GLCRQ
YTPEGQNPSSATVLVAGGFAGIASWITATPFDVIKSRMQMDGLKGRKYGGMLDCMASSF 250

  Fly   257 RNLMATEGPKALFRGILPILLRAFPSTAAVFFGVE 291
            |.    ||....|:|:.....||||..||.|...|
Mouse   251 RQ----EGIGVFFKGMTLNSARAFPVNAATFLSYE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 35/92 (38%)
Mito_carr 111..205 CDD:278578 41/104 (39%)
Mito_carr 208..297 CDD:278578 35/90 (39%)
Slc25a45NP_001348902.1 Solcar 1 1..83 35/88 (40%)
Mito_carr 2..77 CDD:278578 33/82 (40%)
Mito_carr 95..186 CDD:278578 37/90 (41%)
Solcar 2 97..191 40/96 (42%)
Mito_carr 197..288 CDD:278578 34/89 (38%)
Solcar 3 199..286 34/87 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1776
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.