DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and Slc25a47

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_011242283.1 Gene:Slc25a47 / 104910 MGIID:2144766 Length:313 Species:Mus musculus


Alignment Length:311 Identity:100/311 - (32%)
Similarity:150/311 - (48%) Gaps:49/311 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAPLVGVTPI 89
            |:|.|.||:||||:|||:||        ..:|.|:..|...|:|.|...|||||:|.|:..|:.:
Mouse    13 GVCGVAVGYPLDTVKVRIQT--------EAKYAGIWHCIRDTYRQERVWGFYRGLSLPVCTVSLV 69

  Fly    90 YAVDFAVY------AAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQT-- 146
            .:|.|..|      ....|...||  .:.|...|..:|..:|:....:|.||:..||.|||||  
Mouse    70 SSVSFGTYHHCLAHICRFRYGSTD--AKPTKADITLSGCASGLVRVFLTSPTEVAKVRLQTQTQA 132

  Fly   147 -----------VSNGPLL-------------YNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPT 187
                       .|..|.|             |:|.:.....:.|:.|:|.|:||:.|.:||:..:
Mouse   133 QTQQRRSSASWTSGAPALCPTPTACLEPRPKYSGPLHCLVTVAREEGLRGLYKGSSALLLREGHS 197

  Fly   188 -GFYFVTYEFLQELARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKH- 250
             ..||::|..|.|.. ..:.:.:......:::||.||::.|.:|.|.||:|||||:..:|.::: 
Mouse   198 FATYFLSYAMLCEWL-TPAGHSQPDVLGVLVAGGCAGVLAWAVATPMDVIKSRLQADGQGQHRYR 261

  Fly   251 GIRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVE----LTNDLL 297
            |:.......:..|||:.||:|:.....||||....||...|    ||..||
Mouse   262 GLLHCVVTSVREEGPRVLFKGLALNCCRAFPVNMVVFVAYEAVLRLTQSLL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 32/87 (37%)
Mito_carr 111..205 CDD:278578 33/120 (28%)
Mito_carr 208..297 CDD:278578 31/93 (33%)
Slc25a47XP_011242283.1 Mito_carr 13..77 CDD:365909 30/71 (42%)
Mito_carr 103..213 CDD:365909 31/110 (28%)
Mito_carr 226..307 CDD:365909 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.