DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and SLC25A15

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_055067.1 Gene:SLC25A15 / 10166 HGNCID:10985 Length:301 Species:Homo sapiens


Alignment Length:303 Identity:99/303 - (32%)
Similarity:155/303 - (51%) Gaps:26/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KSNP-VKSFI---AGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEG 71
            |||| :::.|   ||..||...||.|.|.||:||::||.       |..|:|:.||..:|:...|
Human     2 KSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTF-------PDLYRGLTDCCLKTYSQVG 59

  Fly    72 FRGFYRGISAPLVGVTPIYAVDFAVYA----AGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVT 132
            |||||:|.|..|:......:|.|..|.    ..:::...|...:|:..|..|||:.|...:|||.
Human    60 FRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVL 124

  Fly   133 VPTDRIKVLLQT--QTVSNGPLLYN-GTIDTAAK-LYRQGGIRSLFKGTCACILRDSPTGFYFVT 193
            .||:.:|..|||  :..::|.:..: .|:.:..| :.|:.|....:.|..:.:||:.| |::|..
Human   125 CPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVP-GYFFFF 188

  Fly   194 YEFLQELARKKSANGK----ISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRS 254
            ..:  ||:|...|:|:    :.....:||||..||..|....|.|.:|||:|.......:.|...
Human   189 GGY--ELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIR 251

  Fly   255 VFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDLL 297
            .|.|::..||..||:.|:.|.::||||:..|:|...|.:..|:
Human   252 TFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLM 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 37/103 (36%)
Mito_carr 111..205 CDD:278578 29/97 (30%)
Mito_carr 208..297 CDD:278578 30/92 (33%)
SLC25A15NP_055067.1 Solcar 1 7..91 33/90 (37%)
Mito_carr 9..94 CDD:365909 33/91 (36%)
Solcar 2 104..197 29/95 (31%)
Mito_carr 122..198 CDD:365909 22/78 (28%)
Mito_carr 207..296 CDD:365909 30/88 (34%)
Solcar 3 207..293 29/85 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.