DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and slc25a47

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_004917228.1 Gene:slc25a47 / 100496270 XenbaseID:XB-GENE-6041480 Length:293 Species:Xenopus tropicalis


Alignment Length:298 Identity:103/298 - (34%)
Similarity:149/298 - (50%) Gaps:43/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAP 82
            ||||.:||.|.|:||:||||:|||:||.        ..|.|:..|...|::.|...||::|:|.|
 Frog     4 FIAGALGGACGVMVGYPLDTVKVRIQTQ--------KNYNGIWHCVRSTYKMERVSGFFKGVSMP 60

  Fly    83 LVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYP---------QIFAAGALAGVCSALVTVPTDRI 138
            :..|:...::.|.||....|     :..:|.|.         .||.:|..||....||:.|.|..
 Frog    61 MSMVSVSSSIVFGVYRNVLR-----NLCK
LKYGTTAVKPSKFDIFLSGYAAGGAQILVSSPADMA 120

  Fly   139 KVLLQTQ---------TVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPT-GFYFVT 193
            ||.||||         ::..|| .|:|.|:....:.::.|...|:||:.|.:.||..: ..||::
 Frog   121 KVRLQTQMCPPNSTTCSLLTGP-KYSGPINCLLTIVKEEGFLGLYKGSSALMFRDCHSFATYFLS 184

  Fly   194 YEFLQE--LARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYKHGIRSVF 256
            |..|:|  |..::|.:..|   ..:.:||.||:|.|.:|.|.||:|||||  .:|..|...|.|.
 Frog   185 YAILREWLL
PFEQSHSELI---GVLFAGGFAGVVAWGIATPMDVIKSRLQ--VDGVTKQRYRGVI 244

  Fly   257 RNL---MATEGPKALFRGILPILLRAFPSTAAVFFGVE 291
            ..:   :..||...||:|:....|||||....||...|
 Frog   245 HCITESVRQEGITVLFKGLSLNCLRAFPVNMVVFLTYE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 34/88 (39%)
Mito_carr 111..205 CDD:278578 35/114 (31%)
Mito_carr 208..297 CDD:278578 33/87 (38%)
slc25a47XP_004917228.1 Mito_carr 1..84 CDD:395101 34/92 (37%)
Mito_carr 100..193 CDD:395101 31/93 (33%)
Mito_carr 198..286 CDD:395101 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.