DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and slc25a45

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_012816001.1 Gene:slc25a45 / 100127755 XenbaseID:XB-GENE-1006763 Length:332 Species:Xenopus tropicalis


Alignment Length:275 Identity:94/275 - (34%)
Similarity:135/275 - (49%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAPLVGVTPIYAVDFAVYAAGKRLF 104
            |||||.        .||:|::||..:|:|.|...||::|:|.|:..|....::.|..| :...|:
 Frog    70 VRLQTQ--------SRYRGILDCVIQTYRNETIFGFFKGMSFPVGSVAISNSLAFGSY-SNALLY 125

  Fly   105 QTDDHIR--LTYP---QIFAAGALAGVCSALVTVPTDRIKVLLQTQTVSNG--------PLLYNG 156
            .:|..|:  ...|   .:|.||..:|:.....:.|.|.:||.||.||.|.|        ...|.|
 Frog   126 LSDQEIKNWKNPPHNCHVFMAGCFSGIVQLSFSAPVDLVKVRLQNQTESFGNQARPGHLQARYQG 190

  Fly   157 TIDTAAKLYRQGGIRSLFKGTCACILRDSPT-GFYFVTYEFLQELARKKSANGKISTTSTILSGG 220
            .:..|..::|:.||..|::|..|..|||.|: |.||:|||.|.:...|  :..:.|..:.:.:||
 Frog   191 PVHCAVCIFREEGIFGLYRGCLALALRDIPSMGLYFLTYEVLCKWMTK--SLDEPSAWTMLFAGG 253

  Fly   221 TAGIVFWTLAVPFDVLKSRLQ-SAPEGTYKHGIRSVFRNLMATEGPKALFRGILPILLRAFPSTA 284
            .||.|.|..|.|.||:|:||| ....|....|:....|..:..||.|...:|:....|||||..|
 Frog   254 CAGTVGWAFANPMDVIKARLQMDGMHGVQYLGMLDCIRKSIRQEGVKVFLKGLTINSLRAFPVNA 318

  Fly   285 AVFFGVELTNDLLKA 299
            ..|...|:   ||||
 Frog   319 VTFLSYEM---LLKA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 22/66 (33%)
Mito_carr 111..205 CDD:278578 36/107 (34%)
Mito_carr 208..297 CDD:278578 30/89 (34%)
slc25a45XP_012816001.1 Mito_carr <70..128 CDD:278578 22/66 (33%)
Mito_carr 144..240 CDD:278578 35/97 (36%)
Mito_carr 241..332 CDD:278578 34/93 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.