DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MME1 and slc25a29

DIOPT Version :9

Sequence 1:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001096191.1 Gene:slc25a29 / 100124740 XenbaseID:XB-GENE-5763797 Length:301 Species:Xenopus tropicalis


Alignment Length:281 Identity:99/281 - (35%)
Similarity:137/281 - (48%) Gaps:16/281 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRGISAP 82
            |.||..||...||||||.||:|||||....    ..|:|:|.|.|.....:.|...|.|:||.:|
 Frog     5 FFAGCAGGAAGVLVGHPFDTVKVRLQVQSV----SNPKYRGTIHCFQSIIKQESTLGLYKGIGSP 65

  Fly    83 LVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLLQTQ-- 145
            ::|:|.|.|:.|.|.....|....|..:..     |.|||.||....::..|.:..|..:|.|  
 Frog    66 MMGLTFINALVFGVQGNTLRYLGKDTPLNQ-----FLAGAAAGSIQCVICCPMELAKTRMQLQGT 125

  Fly   146 -TVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPT-GFYFVTYEFLQELARKKSANG 208
             ...:....|..::|...|:||:.|:|.:.:|.....||::|: ||||:||::|......: .|.
 Frog   126 GEYKSRSKTYKNSLDCMVKIYRKEGVRGINRGMVTTFLRETPSFGFYFLTYDYLTRYLGCE-IND 189

  Fly   209 KISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTYK--HGIRSVFRNLMATEGPKALFRG 271
            .......:.:||.:|||.|....|.||:|||||:...|...  :||....|.....||.:...||
 Frog   190 TFIIPKLLFAGGMSGIVSWLSTYPIDVIKSRLQADGIGGVNNYNGIMDCVRKSYKEEGWRVFSRG 254

  Fly   272 ILPILLRAFPSTAAVFFGVEL 292
            :...||||||..||.|..|.|
 Frog   255 LTSTLLRAFPVNAATFATVTL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 36/88 (41%)
Mito_carr 111..205 CDD:278578 28/97 (29%)
Mito_carr 208..297 CDD:278578 33/87 (38%)
slc25a29NP_001096191.1 Mito_carr 16..89 CDD:365909 31/76 (41%)
Mito_carr 91..184 CDD:365909 28/97 (29%)
Mito_carr 193..272 CDD:365909 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.