DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gart and ADE8

DIOPT Version :9

Sequence 1:NP_001285698.1 Gene:Gart / 33986 FlyBaseID:FBgn0000053 Length:1353 Species:Drosophila melanogaster
Sequence 2:NP_010696.3 Gene:ADE8 / 852017 SGDID:S000002816 Length:214 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:68/202 - (33%)
Similarity:107/202 - (52%) Gaps:21/202 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1155 RVAVLISGTGSNLQALIDATRDSAQGIHADVVLVISNKTGVLGLQRATQAGIPSLV--------- 1210
            |:.|||||:||||||||||.:....|..|.:|.|||:.....||.||....||:.|         
Yeast     3 RIVVLISGSGSNLQALIDAQKQGQLGEDAHIVSVISSSKKAYGLTRAADNNIPTKVCSLYPYTKG 67

  Fly  1211 ISHKDFA----SREVYDAELTRNLKAARVDLICLAGFMRVLSAPFVREWRG-RLVNIHPSLLPKY 1270
            |:.:|.|    :|..::.:|.:.:...:.|:|..||::.:|.:.|:.:.:. .::|:||:|...:
Yeast    68 IAKEDKAARAKARSQFENDLAKLVLEEKPDVIICAGWLLILGSTFLSQLQSVPILNLHPALPGCF 132

  Fly  1271 PG-LHVQKQALEAGEKE-----SGCTVHFVDEGVDTGAIIVQAAVPILPDDDE-DSLTQRIHKAE 1328
            .| .|..:.|....:.|     :||.||:|.|.||.|..:|...:.|:|.::. :...||:|.||
Yeast   133 DGTTHAIEMAWRKCQDENKPLTAGCMVHYVIEEVDKGEPLVVKKLEIIPGEETLEQYEQRVHDAE 197

  Fly  1329 HWAFPRA 1335
            |.|...|
Yeast   198 HIAIVEA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GartNP_001285698.1 PRK00885 4..433 CDD:234856
GARS_N 4..107 CDD:280931
GARS_A 108..301 CDD:279419
GARS_C 337..430 CDD:280930
PRK05385 442..752 CDD:235439
PurM 485..752 CDD:100032
PRK05385 836..1122 CDD:235439
PurM 840..1123 CDD:100032
FMT_core_GART 1155..1339 CDD:187714 68/202 (34%)
ADE8NP_010696.3 Formyl_trans_N 2..205 CDD:395436 68/202 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I1688
eggNOG 1 0.900 - - E1_COG0299
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S947
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.